Skip to content
Free Shipping$250 away
←Back to Collection
Healing

IGF-1LR3

≥99% HPLC Verified
$85.00/ vial
1
Save to Wishlist

For in vitro laboratory research use only. Not for human or veterinary use. Not evaluated by the FDA. Must be 21+ to purchase.

IGF-1LR3
CAS Number946870-92-4
Molecular FormulaC400H625N111O115S9
Molecular Weight9117.5 g/mol
Purity≥99% (HPLC)
Storage−20°C · Lyophilized
FormLyophilized Powder

Ever Vital lists IGF-1 LR3 as Long Arginine 3 IGF-1, a recombinant IGF-1 analog carrying an N-terminal extension and an Arg3 substitution. It carries the molecular formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆ and a molecular weight of 9111.6 g/mol (CAS: 143045-27-6). Structurally it mirrors endogenous peptides while extending the sequence.

Amino Acid SequenceMFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK
Long ArginineIGF-1 ReceptorPI3K/AKT Signaling Pathway

Mechanism of Action

IGF-1 ReceptorReceptor interaction

Across cell-tissue models, the research record has IGF-1 LR3 modulating signaling cascades at the IGF-1 receptor.

PI3K/AKT Signaling PathwaySignaling cascade

In cellular environments, the peptide shows selective binding along the PI3K/AKT signaling pathway with the corresponding pathway activation.

Recommended Storage−20°C · Lyophilized
FormLyophilized (freeze-dried) powder
Temperature-20°C for long-term storage
Light SensitivityProtect from direct light
StabilityStable for 24 months when stored properly
NotesResearch-grade sequence verification via standard assays.

What is IGF-1 LR3?

Ever Vital lists IGF-1 LR3 as Long Arginine 3 IGF-1, a recombinant IGF-1 analog carrying an N-terminal extension and an Arg3 substitution. It carries the molecular formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆ and a molecular weight of 9111.6 g/mol (CAS: 143045-27-6). Structurally it mirrors endogenous peptides while extending the sequence.

Amino Acid Sequence:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK
Classification: Long ArginineIGF-1 ReceptorPI3K/AKT Signaling Pathway

Specifications

CAS Number946870-92-4
Molecular FormulaC400H625N111O115S9
Molecular Weight9117.5 g/mol
Purity≥99% (HPLC verified)
FormLyophilized powder
Storage−20°C · Lyophilized

Mechanism of Action

IGF-1 Receptor

Receptor interaction

Across cell-tissue models, the research record has IGF-1 LR3 modulating signaling cascades at the IGF-1 receptor.

PI3K/AKT Signaling Pathway

Signaling cascade

In cellular environments, the peptide shows selective binding along the PI3K/AKT signaling pathway with the corresponding pathway activation.

Storage & Handling

Temperature:-20°C for long-term storage
Light Sensitivity:Protect from direct light
Stability Duration:Stable for 24 months when stored properly
Research-grade sequence verification via standard assays.

Research Use Only

All compounds are sold strictly for laboratory research use. Not for human use. These products are not drugs, supplements, or food. Statements have not been evaluated by the FDA. Must be 21+ to purchase. This compound is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.