What is IGF-1LR3 used for?

IGF-1LR3 is a synthetic peptide compound studied in laboratory research settings. Scientific literature has explored its properties in preclinical studies. It is not approved for human use.

What purity level does Ever Vital's IGF-1LR3 have?

Ever Vital supplies IGF-1LR3 at 99%+ purity, verified by third-party HPLC and mass spectrometry analysis. Certificates of Analysis are available upon request.

How is IGF-1LR3 supplied?

IGF-1LR3 is supplied as a lyophilized powder in sealed research-grade vials, intended for in vitro and laboratory research use only.

Free Shipping$250 away

←Back to Collection

Healing

IGF-1LR3

Name: IGF-1LR3
Brand: Ever Vital
SKU: EV-IGF1LR3

≥99% HPLC Verified

$85.00/ vial

Save to Wishlist

For in vitro laboratory research use only. Not for human or veterinary use. Not evaluated by the FDA. Must be 21+ to purchase.

CAS Number946870-92-4

Molecular FormulaC₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉

Molecular Weight9117.5 g/mol

Purity≥99% (HPLC)

Storage−20°C · Lyophilized

FormLyophilized Powder

Ever Vital lists IGF-1 LR3 as Long Arginine 3 IGF-1, a recombinant IGF-1 analog carrying an N-terminal extension and an Arg3 substitution. It carries the molecular formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆ and a molecular weight of 9111.6 g/mol (CAS: 143045-27-6). Structurally it mirrors endogenous peptides while extending the sequence.

Amino Acid Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK

Long ArginineIGF-1 ReceptorPI3K/AKT Signaling Pathway

Mechanism of Action

IGF-1 ReceptorReceptor interaction

Across cell-tissue models, the research record has IGF-1 LR3 modulating signaling cascades at the IGF-1 receptor.

PI3K/AKT Signaling PathwaySignaling cascade

In cellular environments, the peptide shows selective binding along the PI3K/AKT signaling pathway with the corresponding pathway activation.

Recommended Storage−20°C · Lyophilized

FormLyophilized (freeze-dried) powder

Temperature-20°C for long-term storage

Light SensitivityProtect from direct light

StabilityStable for 24 months when stored properly

NotesResearch-grade sequence verification via standard assays.

What is IGF-1 LR3?

Amino Acid Sequence:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK

Classification: Long ArginineIGF-1 ReceptorPI3K/AKT Signaling Pathway

Specifications

CAS Number	946870-92-4
Molecular Formula	C400H625N111O115S9
Molecular Weight	9117.5 g/mol
Purity	≥99% (HPLC verified)
Form	Lyophilized powder
Storage	−20°C · Lyophilized

Mechanism of Action

IGF-1 Receptor

Receptor interaction

Across cell-tissue models, the research record has IGF-1 LR3 modulating signaling cascades at the IGF-1 receptor.

PI3K/AKT Signaling Pathway

Signaling cascade

In cellular environments, the peptide shows selective binding along the PI3K/AKT signaling pathway with the corresponding pathway activation.

Storage & Handling

Temperature:-20°C for long-term storage

Light Sensitivity:Protect from direct light

Stability Duration:Stable for 24 months when stored properly

Research-grade sequence verification via standard assays.

Related Compounds

BPC-157 TB-500 CJC-1295 NO DAC

Research Use Only

All compounds are sold strictly for laboratory research use. Not for human use. These products are not drugs, supplements, or food. Statements have not been evaluated by the FDA. Must be 21+ to purchase. This compound is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.

IGF-1LR3

Compound Profile